| Contents per vial | 10 mg |
|---|---|
| Form | Lyophilized powder |
| Packaging | Sealed glass vial |
| Purity | 99,3 % |
| Storage | 2–8 °C, keep dry and protect from light |
| Molecular formula | C221H366N72O67S |
| Molecular weight | 5135,90 g/mol |
| Sequence or structure | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL–NH2 |
| CAS | 218949-48-5 |
| Intended use | For laboratory research only |
About this product
Tesamorelin is a stabilized GHRH analog that stimulates the pituitary gland to release growth hormone and increases IGF-1. The active substance has an approved medical use in the USA for the reduction of excess visceral fat in adults with HIV lipodystrophy. Research is therefore specifically devoted to visceral fat, the GH/IGF-1 axis and the metabolic consequences of this hormonal signaling.
What is Tesamorelin?
Tesamorelin is classified as a “synthetic peptide or peptide analog” and is evaluated in scientific research in relation to areas such as visceral fat, GH and IGF-1, body composition, metabolic parameters. Attention is paid to its interaction with relevant receptors, enzymes or cellular pathways and subsequent changes in measurable laboratory parameters.
Mechanism of action under investigation
Tesamorelin activates the GHRH receptor on the pituitary gland, increases the pulsatile release of GH and subsequently the production of IGF-1.
MAIN AREAS OF RESEARCH
• Visceral fat: Tesamorelin is being studied for reducing the amount of visceral fat – fat stored deep in the abdominal cavity around the internal organs.
• GH and IGF-1: As an analogue of GHRH, it stimulates the pituitary gland to release growth hormone and subsequently increases IGF-1 signaling.
• Body composition: Clinical studies monitor changes in visceral and subcutaneous fat, muscle mass and other parameters of body composition.
• Liver fat and metabolic parameters: Research also includes the amount of liver fat, lipids and other metabolic indicators in specific clinical populations.
Research findings to date
Work to date on the substance Tesamorelin is devoted to areas that include visceral fat, GH and IGF-1, body composition, metabolic parameters. Results should be assessed according to the level of evidence: cell and animal models.
