| Contents per vial | 5 mg |
|---|---|
| Form | Lyophilized powder |
| Packaging | Sealed glass vial |
| Purity | 99,82 % |
| Storage | 2–8 °C, keep dry and protect from light |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493,26 g/mol |
| Sequence or structure | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| CAS | 154947-66-7 |
| Intended use | For laboratory research only |
About this product
LL-37 is the only known human cathelicidin antimicrobial peptide. It is part of innate immunity and can directly interact with the membranes of microorganisms. In addition to antimicrobial activity, it affects inflammation, chemotaxis, healing and cell signaling. Research includes bacteria, viruses, biofilms, skin and immune response. Its effects are context-dependent, and excessive activity can also be associated with pathological inflammation.
What is LL-37?
LL-37 is classified as a “synthetic peptide or peptide analog” and is being evaluated in scientific research in areas such as antimicrobial activity, biofilms, innate immunity, and wound healing. Attention is paid to its interaction with relevant receptors, enzymes or cellular pathways and subsequent changes in measurable laboratory parameters.
Mechanism of action under investigation
LL-37 is an amphipathic peptide that can disrupt microbial membranes while binding to multiple cellular receptors and nucleic acids, thereby modulating immune signaling.
MAIN AREAS OF RESEARCH
• Antimicrobial activity: LL-37 is a natural human antimicrobial peptide investigated for direct activity against selected bacteria, viruses and fungi.
• Biofilms: Research is looking at how LL-37 affects the formation and stability of biofilms – protective communities of microorganisms that are more resistant to the environment.
• Innate immunity: LL-37 also functions as a signal for immune cells and is studied for the regulation of chemotaxis, cytokines and the body’s first line of defense.
• Wound healing: The peptide is investigated in the processes of skin cell migration, re-epithelialization and restoration of the damaged skin barrier.
• Inflammation: Depending on the environment, LL-37 can dampen and promote inflammatory signals, therefore its regulatory role in various types of tissue damage is being investigated.
Research findings to date
Results should be judged according to the level of evidence: cellular and animal. Research includes bacteria, viruses, biofilms, skin and immune response. Data on adverse effects in humans are limited or depend on the specific research protocol. With experimental peptides, the risk of a local reaction, immunogenicity or an unpredictable biological response must also be taken into account; these possibilities cannot be considered a complete clinical list.
